Saturday, June 3, 2023
Ruetir
  • Home
  • World
  • Lifestyle
    What is the organ that regenerates with only its third part?

    What is the organ that regenerates with only its third part?

    Miracle fruit!  Increases collagen production, lowers cholesterol and reduces sugar levels

    Miracle fruit! Increases collagen production, lowers cholesterol and reduces sugar levels

    How is polio spread and what are the symptoms?

    How is polio spread and what are the symptoms?

    Being smart with emotions

    Being smart with emotions

    healthy mind in healthy body

    healthy mind in healthy body

    Use anxiety to your advantage

    Use anxiety to your advantage

    Trending Tags

    • Pandemic
  • Business
  • Entertainment
  • Sports
No Result
View All Result
  • Home
  • World
  • Lifestyle
    What is the organ that regenerates with only its third part?

    What is the organ that regenerates with only its third part?

    Miracle fruit!  Increases collagen production, lowers cholesterol and reduces sugar levels

    Miracle fruit! Increases collagen production, lowers cholesterol and reduces sugar levels

    How is polio spread and what are the symptoms?

    How is polio spread and what are the symptoms?

    Being smart with emotions

    Being smart with emotions

    healthy mind in healthy body

    healthy mind in healthy body

    Use anxiety to your advantage

    Use anxiety to your advantage

    Trending Tags

    • Pandemic
  • Business
  • Entertainment
  • Sports
No Result
View All Result
Ruetir
No Result
View All Result
Home Games

Asus TUF Gaming H1 Headset: Quality and performance well above its market value | Ruetir.com

Ruetir by Ruetir
January 31, 2023
in Games
0
Asus TUF Gaming H1 Headset: Quality and performance well above its market value |  Ruetir.com
0
SHARES
1
VIEWS
Share on FacebookShare on Twitter

Very good friends, this time we are lucky to review a headset, which has a simple design, devoid of the common RGB today or anything very flashy, but with a quality and performance far superior to its market value.


At first glance we have a simple box, with a very clean design and quite clear in terms of its use and compatibility.

When we first took the TUF Gaming H1 out of the box, we didn’t think much of it. It’s not much to look at and it feels underwhelming in the hand. But once you put it on your head, you appreciate some of the hidden joys of design.


The contents of the box are quite basic and simple, with the earpiece, a splitter cable, and its corresponding manual. The Headset is very light, which makes it very comfortable in daily use.


The Gaming H1 also features a material strap headband design, much like the SteelSeries headset, that rests smoothly on the head, rather than any metal or plastic headband. This offers a soft feel for all-day comfort that makes it easy to wear.

The ear cups are 100% protein leather and are quite large as well. The inside diameter of these headphones provides plenty of room, top to bottom and side to side, to accommodate larger ears. Unfortunately, they’re not as deep as we’d like, so there’s a bit of pressure against the outside where the lug sits against the driver.

The headband design is also quite rigid. Although the earcups tilt up and down, they won’t move from side to side, so it can be difficult to adjust.


The headband is also not stretchable in the traditional way, but instead relies on the flexibility of the elastic fabric suspension headband and the large size of the design.

The Asus TUF Gaming H1 is a stereo headset with 40mm drivers with virtual surround sound via Windows Sonic or Dolby Atmos sound.


It’s nice and loud, with a basic volume wheel on the left ear cup that you can easily adjust. We found the sound to be reasonably capable, too.

Unsurprisingly, the TUF Gaming H1 has a unidirectional boom mic. That mic can be easily adjusted so you can position it however you like: move it out of the way when you need it, and close it when you want to talk. It is said to be certified by Teamspeak and Discord, but it does not have AI noise cancellation capabilities.


Specifications

– Product Type5mm headset

– Usage Scenario Gaming

– InterfaceWired

– Connector5mm

– PC, MAC, PlayStation® 4, PlayStation® 5, Nintendo Switch, Xbox one, Xbox Series X, Xbox Series S

– Driver MaterialNeodymium magnet

– Driver Size 40 mm

– Headphones Impedance 60 ohm

– Headphones Frequency Response 20Hz – 20Khz

– Microphone Pick-up Pattern Unidirectional

– Microphone Sensitivity-45dB

– Microphone Frequency Response100Hz – 10Khz

– AI Noise Cancelling MicrophoneNo

– Active Noise CancellationNo

– Channel Stereo, Virtual 7.1(Windows sonic)
– Aura No

– Weight287 g

– Extra ear-cushion No

– ColorBlack

– Cable2m + 1.2 m Y-cable

– Accessories 5 mm mic/audio- splitter cable, Quick Start Guide

This headset is good enough for watching movies, listening to music, and gaming. The sound is a bit hollow, though: it lacks the bass and range of other more expensive gaming headsets, so some of the richness is lost.

The above does not affect the initial conclusion, that is, for its price the sound and quality of the headset is excellent

The Asus TUF Gaming H1 also comes with a splitter cable, so you can easily connect it to your console, PC, or other devices.


This dividing cable also provides an additional length to the headset, which helps to start the cable that comes directly to the headset, since sometimes it can be somewhat short, depending on the setup and use of the headset.

In short, the Asus TUF Gaming H1 is a no-frills headset that’s affordably priced, but surprisingly good for the money, with audio quality that belies its price and a lightweight build that’s very nice in everyday use.

Now, as we previously mentioned, the sound isn’t that rich in terms of bass or audio range, the microphone can’t be removed, and the depth of the earcups isn’t deep enough for our liking.

So the TUF Gaming H1 probably won’t blow your mind, but it’s not going to break the bank either.



Editorial: Gaming / Facebook / Twitter / Coverage / Instagram / Discord

Tags: animeASUScinemacomicsgame newsgamergamingheadsetmarketperformancequalityreviewsRuetir.comtarreotarreo newsTUFvideo game newsvideo games

Related Posts

Cartoons on the Bay 2023: RAI and videogames together soon |  Ruetir.com
Games

Cartoons on the Bay 2023: RAI and videogames together soon | Ruetir.com

by Ruetir
June 3, 2023
Cartoons on the Bay 2023 kicks off today: here is the complete program |  Ruetir.com
Games

Cartoons on the Bay 2023: Bruno Bozzetto is the protagonist of the panel “Spreading awareness through animation” | Ruetir.com

by Ruetir
June 3, 2023
Captain Tsubasa Dream Team: Sixth Anniversary Campaign Announced |  Ruetir.com
Games

Captain Tsubasa Dream Team: Sixth Anniversary Campaign Announced | Ruetir.com

by Ruetir
June 3, 2023
Cartoons On The Bay 2023: Ian Mackinnon will collect the Studio of the Year award |  Ruetir.com
Games

Cartoons on the Bay 2023: the June 3 program | Ruetir.com

by Ruetir
June 3, 2023
Overwatch 2 removed police patrols on a map for LGTBIQ+ Pride Month and promises to include a trans character |  Ruetir.com
Games

Overwatch 2 removed police patrols on a map for LGTBIQ+ Pride Month and promises to include a trans character | Ruetir.com

by Ruetir
June 3, 2023
Next Post

Twente fire brigade recites Glanerbrugse toddlers from their own work: "Good for language development"

Leave a Reply Cancel reply

Your email address will not be published. Required fields are marked *

Editors' Choice

Giri draws and shares first position with four other chess players

Giri draws and shares first position with four other chess players

January 16, 2023
Zero Motorcycles and IMI Announce Strategic Partnership – News

Zero Motorcycles and IMI Announce Strategic Partnership – News

March 29, 2023
Backstreet Boys: Nick Carter would release song dedicated to his brother, Aaron Carter

Backstreet Boys: Nick Carter would release song dedicated to his brother, Aaron Carter

January 12, 2023

Browse by Category

  • Automobile
  • Business
  • Economy
  • Entertainment
  • Games
  • Health
  • Lifestyle
  • Sports
  • Technology
  • World

Browse by Tags

2023 anime China cinema day euros Free gallery game games Icona inter Kingdom League Mario Marvel milan MotoGp movie news Nintendo playstation pokémon price Reveals Ruetir Ruetir.com russia scooter season series Super Switch tears test time Today Trailer Ukraine United States Video World Xbox years Zelda
Ruetir

Latest News, World News, Breaking News, Games,Technology, Business, Lifestyle, Fashion, Sports, Food & Technology.

Categories

  • Automobile
  • Business
  • Economy
  • Entertainment
  • Games
  • Health
  • Lifestyle
  • Sports
  • Technology
  • World

Browse by Tag

2023 anime China cinema day euros Free gallery game games Icona inter Kingdom League Mario Marvel milan MotoGp movie news Nintendo playstation pokémon price Reveals Ruetir Ruetir.com russia scooter season series Super Switch tears test time Today Trailer Ukraine United States Video World Xbox years Zelda

Recent Posts

  • Gasp dribbling on the future: “We’ve been talking about it since Monday. Now I want the Europa League”
  • Mercedes extends Russell until 2025, Hamilton stalls
  • Live: Excelsior’31 ahead against Genemuiden, SVZW in pursuit
  • About Us
  • Home
  • Privacy Policy

© Ruetir 2023. All Rights Reserved.

No Result
View All Result
  • Home
  • World
  • Lifestyle
  • Business
  • Entertainment
  • Sports

© Ruetir 2023. All Rights Reserved.

Ruetir